PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005859-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 827aa    MW: 91434.7 Da    PI: 7.1295
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005859-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-075294347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e + +a +q G++ +++I  +++  +   q++++++ +
    NNU_005859-RA 52 AWTRQEEESFFNALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 94
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-94399IPR009057Homeodomain-like
PROSITE profilePS5129312.5884899IPR017884SANT domain
SMARTSM007172.0E-44997IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-45097IPR009057Homeodomain-like
CDDcd001679.38E-55295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MHSKPQVALE CATSLPSENP LLKDGDSCLT SSSQNIVAPQ QPVKKQTRQW AAWTRQEEES  60
FFNALRQVGK NFEKITCRVQ SKNKDQVRHY YYRLVRRMNK LLSPGFSLDA KNSKDTIAAM  120
LRWWSLLEKY SCKASKLHLK PRRLKLFVEA LEHQLLKDRK KSIRKRPSQG EYCSSASPTA  180
VLLQNKAPGL DTRSVKLVAV DNQSIQKVVS GKGSALKRNV NTGINRSNNK CHSSTSKTGR  240
QRRKTGASPA AYKRWEKAAM AGVSLVADAA EHLERSTTNK KDCTEEGTLI KPFPGPVDPA  300
NAQKGDPVGV RPPLSMSTSV QQLTDSGAQQ SLKLKLQLFP IDEVTRRALE KDEHNPHLEL  360
TLSARKKISS VLEHLNRKWG NSGIASGDLI LFPYSVQREN LMGYPRWKQD TVASAADVYA  420
MIGSPPVFRL RYGWFSSTDL ESICRASSSY HIQEQHTSIN RSNIKESTDA TLPILSTCHH  480
SEHLLDCFKD RVTLMTESSL ILPLHADCCE DVIGCAEDQE ISLPVSSANS SWLKKEIGGG  540
IVKGQWEEMD NLRMSNNSTA LLAGEWADGL TNISIGDLLS EASRAADNNC VDPHSLGSSQ  600
YFQQIPFSCD SFDAAIAAHI AAHQEKLNLK SAQVSHATSL WDAEETRDAF SFQKMPTFDQ  660
EVRSPSQHAS FGTCKQISCT SSMSLRALIE ELPEVRPIDD SACEGDSVDD CQSDAYSPDN  720
SPKGLSPENS SKDLSPKNSA NDFSELTDIY WPDSLGPLDL DVPSSRCYKQ DLIFGDSVSF  780
SGLNRFLASS LDTFQNSLFG FDKKELPSTD EVGPNSSLSD DRIGGEV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253972.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X2
TrEMBLD7TQP70.0D7TQP7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.10.0TSL-kinase interacting protein 1